Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496424.1 | internal | 142 | 1-426(+) |
Amino Acid sequence : | |||
RETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIKQHFASNIGVAKSKIREKEPVVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGHAICLHPLVCKGFN ADFDGDQMAVHVPLSLEAQAEA | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,731.216 | ||
Theoretical pI: | 7.975 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 37.896 | ||
aromaticity | 0.056 | ||
GRAVY | 0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.204 | ||
sheet | 0.282 |