Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496432.1 | internal | 128 | 2-385(+) |
Amino Acid sequence : | |||
ETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIKQHFASNIGVAKSKIREKEPVVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGHAICLHPLVCKGFNA DFDGDQMA | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,229.530 | ||
Theoretical pI: | 8.601 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 39.443 | ||
aromaticity | 0.063 | ||
GRAVY | 0.149 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.211 | ||
sheet | 0.258 |