Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496435.1 | internal | 135 | 3-407(+) |
Amino Acid sequence : | |||
RETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIKQHFASNIGVAKSKIREKEPVVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGHAICLHPLVCKGFN ADFDGDQMAVHVPLS | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 15,018.467 | ||
Theoretical pI: | 8.966 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 39.343 | ||
aromaticity | 0.059 | ||
GRAVY | 0.157 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.215 | ||
sheet | 0.252 |