Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496436.1 | internal | 138 | 3-416(+) |
Amino Acid sequence : | |||
RETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIKQHFASNIGVAKSKIREKEPVVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGHAICLHPLVCKGFN ADFDGDQMAVHVPLSLEA | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,331.817 | ||
Theoretical pI: | 8.584 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 38.705 | ||
aromaticity | 0.058 | ||
GRAVY | 0.169 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.210 | ||
sheet | 0.268 |