Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496446.1 | internal | 130 | 1-390(+) |
Amino Acid sequence : | |||
FRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIKQHFASNIGVAKSKIREKEPVVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGHAICLHPLVCKGF NADFDGDQMA | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 14,532.889 | ||
Theoretical pI: | 8.965 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 38.990 | ||
aromaticity | 0.069 | ||
GRAVY | 0.134 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.208 | ||
sheet | 0.254 |