Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496447.1 | internal | 134 | 2-403(+) |
Amino Acid sequence : | |||
FRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIKQHFASNIGVAKSKIREKEPVVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGHAICLHPLVCKGF NADFDGDQMAVHVP | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,965.406 | ||
Theoretical pI: | 8.966 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 39.562 | ||
aromaticity | 0.067 | ||
GRAVY | 0.157 | ||
Secondary Structure Fraction | |||
Helix | 0.366 | ||
turn | 0.209 | ||
sheet | 0.246 |