Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496464.1 | internal | 143 | 1-429(+) |
Amino Acid sequence : | |||
RETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIKQHFASNIGVAKSKIREKEPVVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGHAICLHPLVCKGFN ADFDGDQMAVHVPLSLEAQAEAR | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,887.401 | ||
Theoretical pI: | 8.584 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 37.701 | ||
aromaticity | 0.056 | ||
GRAVY | 0.108 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.203 | ||
sheet | 0.280 |