Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496465.1 | internal | 129 | 1-387(+) |
Amino Acid sequence : | |||
FRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIKQHFASNIGVAKSKIREKEPVVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGHAICLHPLVCKGF NADFDGDQM | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,461.812 | ||
Theoretical pI: | 8.965 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 38.258 | ||
aromaticity | 0.070 | ||
GRAVY | 0.121 | ||
Secondary Structure Fraction | |||
Helix | 0.364 | ||
turn | 0.209 | ||
sheet | 0.248 |