Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496466.1 | internal | 100 | 3-302(+) |
Amino Acid sequence : | |||
SVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIKQHFASNIGVAKSKIREKEPVVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGHAICLHPL | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,154.139 | ||
Theoretical pI: | 9.299 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 42.369 | ||
aromaticity | 0.050 | ||
GRAVY | 0.352 | ||
Secondary Structure Fraction | |||
Helix | 0.390 | ||
turn | 0.210 | ||
sheet | 0.270 |