Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496468.1 | internal | 147 | 1-441(+) |
Amino Acid sequence : | |||
EGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIKQHFASNIGVAKSKIREKEPVVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGHAICLHPLVC KGFNADFDGDQMAVHVPLSLEAQAEAR | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 16,376.926 | ||
Theoretical pI: | 8.601 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 36.948 | ||
aromaticity | 0.061 | ||
GRAVY | 0.067 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.204 | ||
sheet | 0.279 |