Acc_NO	ORF type	length	start-end position (strand +/-)
>KY524822.1	internal	165	1-495(+)
Amino Acid sequence :
VVEEEWPLDADVGWGIRASEYFEKHPIKNIVGEDGVEIDWEGEVDDVKEINCLEWETFAFHPSPLVVLVFERYNRATDNWKALKELEKALQVYWDAKDRLPPRAVKIDINIEKDLAYALK VKEGPQILFVRGNRILYKEKVSRTAEELVQMIAHFYYKAKRPSWI
Physicochemical properties
Number of amino acids:		165
Molecular weight:		19,404.947
Theoretical pI:		5.125
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		48930 48930
Instability index:		35.770
aromaticity		0.121
GRAVY		-0.422
Secondary Structure Fraction
Helix		0.370
turn		0.152
sheet		0.285