Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY524902.1 | internal | 194 | 1-582(+) |
Amino Acid sequence : | |||
PRRKRGRRSEAEAVEDLVRDTLERTLGSMRVVEEEWPLDAEVGWGVRASEYFERHPIRNVVVDGVEIDWEGEMEEVKEVNCLEWESFAFHPSPLIVLVFERYNRAAENWKALMELEKAAK VFWNAKDRLPPRTIKIDMNIETDLAYALKVRECPQLLFLRGNRMVYREKEIRTADELVKMIAHFYYNAKRPSWI | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 10,668.538 | ||
Theoretical pI: | 11.089 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 48.277 | ||
aromaticity | 0.019 | ||
GRAVY | -1.033 | ||
Secondary Structure Fraction | |||
Helix | 0.143 | ||
turn | 0.371 | ||
sheet | 0.267 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY524902.1 | 5prime_partial | 105 | 3-320(+) |
Amino Acid sequence : | |||
EAEAGAAERGGGGGGPRPRHAREDARVDARGGRGVAVGRGGRVGGEGFGVLREAPDKERRRGRGGDRLGGGDGGGEGGELFGVGELRLPPEPAHRPRLRTLQQGS* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 10,668.538 | ||
Theoretical pI: | 11.089 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 48.277 | ||
aromaticity | 0.019 | ||
GRAVY | -1.033 | ||
Secondary Structure Fraction | |||
Helix | 0.143 | ||
turn | 0.371 | ||
sheet | 0.267 |