Acc_NO	ORF type	length	start-end position (strand +/-)
>KY524902.1	internal	194	1-582(+)
Amino Acid sequence :
PRRKRGRRSEAEAVEDLVRDTLERTLGSMRVVEEEWPLDAEVGWGVRASEYFERHPIRNVVVDGVEIDWEGEMEEVKEVNCLEWESFAFHPSPLIVLVFERYNRAAENWKALMELEKAAK VFWNAKDRLPPRTIKIDMNIETDLAYALKVRECPQLLFLRGNRMVYREKEIRTADELVKMIAHFYYNAKRPSWI
Physicochemical properties
Number of amino acids:		194
Molecular weight:		10,668.538
Theoretical pI:		11.089
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		48.277
aromaticity		0.019
GRAVY		-1.033
Secondary Structure Fraction
Helix		0.143
turn		0.371
sheet		0.267

Acc_NO	ORF type	length	start-end position (strand +/-)
>KY524902.1	5prime_partial	105	3-320(+)
Amino Acid sequence :
EAEAGAAERGGGGGGPRPRHAREDARVDARGGRGVAVGRGGRVGGEGFGVLREAPDKERRRGRGGDRLGGGDGGGEGGELFGVGELRLPPEPAHRPRLRTLQQGS*
Physicochemical properties
Number of amino acids:		105
Molecular weight:		10,668.538
Theoretical pI:		11.089
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		48.277
aromaticity		0.019
GRAVY		-1.033
Secondary Structure Fraction
Helix		0.143
turn		0.371
sheet		0.267