Acc_NO	ORF type	length	start-end position (strand +/-)
>KY525051.1	internal	446	1-1338(+)
Amino Acid sequence :
ASSTQFPPLLASHSSVVPEEQTTQDGHDGTKSEGGENLEEKKLDAAFETWKSKTYALTVPLTVAALRGSIPPSWVKDFIQSQGRRSRFQLKLNGSLDGIFSELSVALGKGKVRSSSVVAA DLVSIGDSWLNYAIKQAIIQPIEGVEDQDWFKSLSNKWKVYLSRNSEGNIDPDGKIWAAPYRWGCMVIAYKKSKFRKHNLASIEDWADLWRPELAGRISMVDSPREVVGAVLKYMGASYN TNNISSRVSGGKDSVQKNLALLAKQVRLFDNTQYLKAFGVGDIWVAVGWSSDVLPVAKRMSNVAVVVPKSGASLWADLWVIPAASRLKTNQIGGRIRGPSPLIHQWIEFCLQAARSISFK QEIIPGSSPSALESASVELPRELNKGKPRLDTNLVQGVPPPDILAKCEFLEPLSESSLLDYQWLISGIQKSDHGLVYKLHCNISSL
Physicochemical properties
Number of amino acids:		446
Molecular weight:		12,363.074
Theoretical pI:		9.737
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10095
Instability index:		55.413
aromaticity		0.118
GRAVY		-0.035
Secondary Structure Fraction
Helix		0.291
turn		0.264
sheet		0.282

Acc_NO	ORF type	length	start-end position (strand +/-)
>KY525051.1	complete	110	899-567(-)
Amino Acid sequence :
MRLATGSTSLLQPTATQISPTPNAFRYCVLSNSRTCFASNARFFWTLSFPPLTREEILFVLYDAPMYFRTAPTTSLGESTIEIRPASSGRHKSAQSSMEARLCFRNLLFL*
Physicochemical properties
Number of amino acids:		110
Molecular weight:		12,363.074
Theoretical pI:		9.737
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10095
Instability index:		55.413
aromaticity		0.118
GRAVY		-0.035
Secondary Structure Fraction
Helix		0.291
turn		0.264
sheet		0.282