| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY525213.1 | internal | 327 | 1-981(+) |
Amino Acid sequence : | |||
| NALLHVMVQNRRFRLTRDLFFDKFGVAPNVVTCNVLISALCENGELGSAEKVIDKMPEWGLAPDVVTYTTLVCGYCGRGDLEKAREVFEEMVRQGWVPDETAYTVMIDGYCRHGRVLDAV RFMDRMEDDGILPNEVTYGVVIEAYCREGKPGEALSLMELMLSGKYVPDAPLCFKVIDLLCRVGRLDEACELWGKLLKKNCVPDNAITSTLVYWLCKAGKVWEARKIFKEFEKGFVPSSL TYIALILGLCECGELQEAGSLWDEMVEKGWAPSTFTYNALMKAFVKSGDGIRLFEEMLEKGCMHDRSTFATLVDGIEDEVDRVVKMA | |||
Physicochemical properties | |||
| Number of amino acids: | 327 | ||
| Molecular weight: | 16,237.982 | ||
| Theoretical pI: | 10.281 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 49.206 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.442 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.218 | ||
| sheet | 0.296 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY525213.1 | 3prime_partial | 206 | 620-3(-) |
Amino Acid sequence : | |||
| MALSGTQFFFNSFPHSSHASSSLPTRQSKSMTLKHRGASGTYFPLSINSIKLRASPGFPSLQYASITTPYVTSLGRIPSSSIRSMNLTASNTLPCLQYPSIITVYAVSSGTHPCLTISSN TSLAFSRSPRPQYPHTSVVYVTTSGAKPHSGILSITFSAEPNSPFSHNALINTLHVTTLGATPNLSKNRSRVRRNRRFWTMTWRSA | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 16,237.982 | ||
| Theoretical pI: | 10.281 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 49.206 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.442 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.218 | ||
| sheet | 0.296 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY525213.1 | complete | 142 | 912-484(-) |
Amino Acid sequence : | |||
| MHAPLLQHLLKKPNPIPRLYKRLHERVISESARCPSLLNHFVPQTPRLLKLPTLAQPQNQCDISQRARDEALLKLLKNLPRLPDLPRLAEPVHERARDGIIGHTILLQQLPPQLACLIKP PHPAKQVNDFETQGRVRHVLPT* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,237.982 | ||
| Theoretical pI: | 10.281 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 49.206 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.442 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.218 | ||
| sheet | 0.296 | ||