Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY525942.1 | 3prime_partial | 179 | 1-537(+) |
Amino Acid sequence : | |||
MQRLGEFKLPQFFNYPPYFTLQPVRDTREKQIQLWKELILDYCKTQKIFMIGLEEEFPLFSNPLIERSLSHEAREAFLSALVLEGRAEWLDKGHRKCLTLWHRIPEWADIIQDFVKANGL EDTVMTIEEIRSGIESRGTELHNIDHTILMRALKLLEQKGKLALFKGTSADDEGVKFSM | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 20,952.988 | ||
Theoretical pI: | 5.785 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 40.076 | ||
aromaticity | 0.101 | ||
GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.162 | ||
sheet | 0.318 |