Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY526268.1 | internal | 141 | 1-423(+) |
Amino Acid sequence : | |||
QQWRLVCLALGFTLLLVAPIISNWVPFYYSSSMTIGVFLVIIILLFQGMKLLPTGRKNILYLTLYGSLFGAGSFLVVNSILVNFGWSQEMHNPVFVFLLLGIGLAGAALGYWIVRKYVIS KDGNVDVGVAQFVKWAMRIIG | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 16,324.453 | ||
Theoretical pI: | 7.151 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 65430 65930 | ||
Instability index: | 49.668 | ||
aromaticity | 0.200 | ||
GRAVY | -0.012 | ||
Secondary Structure Fraction | |||
Helix | 0.371 | ||
turn | 0.279 | ||
sheet | 0.171 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY526268.1 | internal | 140 | 3-422(+) |
Amino Acid sequence : | |||
AMASGLFSIGIHAVISGTYNQQLGSFLLQQFNDYWSVSCHYHPSFSGNEIIAYWKEKYIISYFIWIFVWSRIFFGGEFNSCKFWMESGNAQPCLCIFTSGHWPCWSSTGLLDSEEIRYLK RWKCGCWGRSICEMGHANHW | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 16,324.453 | ||
Theoretical pI: | 7.151 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 65430 65930 | ||
Instability index: | 49.668 | ||
aromaticity | 0.200 | ||
GRAVY | -0.012 | ||
Secondary Structure Fraction | |||
Helix | 0.371 | ||
turn | 0.279 | ||
sheet | 0.171 |