Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY526349.1 | internal | 141 | 1-423(+) |
Amino Acid sequence : | |||
QQWRIMCLGIGFMLLLVAPIVSSWVPFYYSSSMALGVMLVILVVLFQGMKLLPGGRKNMLYVAIYGSLLGVGSFILVNSVLINFGLGEEMHKPVSALVLVLIALAGAALGYWFVRKFVLS EDGSVDAGIAQFVKWAMRILA | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,357.481 | ||
Theoretical pI: | 9.464 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29450 | ||
Instability index: | 31.714 | ||
aromaticity | 0.121 | ||
GRAVY | 1.104 | ||
Secondary Structure Fraction | |||
Helix | 0.482 | ||
turn | 0.234 | ||
sheet | 0.326 |