Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY526497.1 | internal | 178 | 1-534(+) |
Amino Acid sequence : | |||
NGIRDLGSKAILSLGVSTAITLGFSVVVAAKVGVNKPELLPKDFSPVIDVAGFLSDGQEKRLAEEIAKIEKDTGFKLRVLAQNYPETPGLAIKDFWQVDDRTIVFVADPTFGNILNFNVG DSIDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISQCLREPVGPNNCSQLK | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 19,437.027 | ||
Theoretical pI: | 5.086 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 33.831 | ||
aromaticity | 0.090 | ||
GRAVY | -0.036 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.253 | ||
sheet | 0.242 |