Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY526570.1 | internal | 186 | 1-558(+) |
Amino Acid sequence : | |||
TSTDSAKWVSQWKSKTLSLAFSGALALGLSLSGLGSADAKVGVNKPELLPKEFSPVLDVAGFLSSGQENRLIQQIVDLEKDTGYKLRILAQNFPDTPGLAIKDFWVPDDRTIVFVADPTF GNIIHFNVGSTVDLDVPRNFWSRVAGKYGNMFYWKEKGEDASIEGAVVAISKCLRDPTNPNNCSEI | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 20,281.744 | ||
Theoretical pI: | 5.198 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32095 | ||
Instability index: | 22.575 | ||
aromaticity | 0.097 | ||
GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.280 | ||
sheet | 0.220 |