Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY526827.1 | internal | 230 | 1-690(+) |
Amino Acid sequence : | |||
DFEKAKMKVRPSAMREVMLEFPKVHWDDIGGQMEAKKQLTEAVQWPQALERIGVQPVKGILMFGPPGCSKTLMARAVASEAGLNFLAVKGPELFSKWVGDSEKAVRLLFAKARANSPSII FFDEIDGLATTRGQENDGTSVADRVLSQLLVEMDGLDQRVGVTIIAATNRPDNIDPALLRPGRFDRSVYVGPPDRKDIFRIHSVLASLTEGYTGADIKLICREAAIAALE | |||
Physicochemical properties | |||
Number of amino acids: | 230 | ||
Molecular weight: | 25,206.809 | ||
Theoretical pI: | 6.252 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 28.306 | ||
aromaticity | 0.065 | ||
GRAVY | -0.115 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.209 | ||
sheet | 0.296 |