Acc_NO	ORF type	length	start-end position (strand +/-)
>KY527245.1	internal	121	1-363(+)
Amino Acid sequence :
EAWTGEIHGKVVCDVCGDSSFGPEDIPLEGAEVAVLCITKSGDVINYQAFANSKGVYTVAETMPESDRWDSCLARPISSFHEHCTRRDSHSGIKFAYTHPSGYSHTVRPFLYRPATAPLY C
Physicochemical properties
Number of amino acids:		121
Molecular weight:		13,314.728
Theoretical pI:		5.590
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19940 20315
Instability index:		45.252
aromaticity		0.107
GRAVY		-0.275
Secondary Structure Fraction
Helix		0.273
turn		0.256
sheet		0.198