Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY527245.1 | internal | 121 | 1-363(+) |
Amino Acid sequence : | |||
EAWTGEIHGKVVCDVCGDSSFGPEDIPLEGAEVAVLCITKSGDVINYQAFANSKGVYTVAETMPESDRWDSCLARPISSFHEHCTRRDSHSGIKFAYTHPSGYSHTVRPFLYRPATAPLY C | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,314.728 | ||
Theoretical pI: | 5.590 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 45.252 | ||
aromaticity | 0.107 | ||
GRAVY | -0.275 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.256 | ||
sheet | 0.198 |