Acc_NO	ORF type	length	start-end position (strand +/-)
>KY527274.1	internal	122	1-366(+)
Amino Acid sequence :
GSWTGEIHGRVVCDVCRDSFIGPEDHILEGAEVAVLCITKSGEVLNYQAFTNSRGIYTVAETMPESDRWDACLARPISSFHELCTHLSDGSSGVKFSYNRPSGYSHTIRAFVYRPVNVPT YC
Physicochemical properties
Number of amino acids:		122
Molecular weight:		13,507.975
Theoretical pI:		5.655
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19940 20315
Instability index:		45.008
aromaticity		0.107
GRAVY		-0.176
Secondary Structure Fraction
Helix		0.303
turn		0.270
sheet		0.180