Acc_NO	ORF type	length	start-end position (strand +/-)
>KY527568.1	internal	150	1-450(+)
Amino Acid sequence :
LQTVDVFAIVALSGILSRLLSTGTVLVATSNRAPEDLNQDGMQKDIFLKLLAKLEDSCQNILVGSEIDYRYFWPLFEVAWGGNIISTTISVMFGRTLDVLESCNGVARFHFNYLCGRPVG AADYIAVAKNYHTVFISDIPVMSMRIGDNA
Physicochemical properties
Number of amino acids:		150
Molecular weight:		16,511.842
Theoretical pI:		4.989
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18575
Instability index:		31.507
aromaticity		0.100
GRAVY		0.341
Secondary Structure Fraction
Helix		0.380
turn		0.227
sheet		0.247