Acc_NO	ORF type	length	start-end position (strand +/-)
>KY528410.1	internal	135	1-405(+)
Amino Acid sequence :
ELLELQEVEKILSDVRADNVKVIPFRKHCDWADFMVIATGRSTWHVKNIAQALIYKVKQKQKGAQRLVLPSVEGQEGGKWIVVDSGRVIVHALDEKARDYYNLEDLWASGKAEEEPQDLE KAFSKVRRKNNSKKP
Physicochemical properties
Number of amino acids:		135
Molecular weight:		15,498.564
Theoretical pI:		8.956
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26470 26470
Instability index:		39.282
aromaticity		0.074
GRAVY		-0.611
Secondary Structure Fraction
Helix		0.311
turn		0.170
sheet		0.259