Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY528410.1 | internal | 135 | 1-405(+) |
Amino Acid sequence : | |||
ELLELQEVEKILSDVRADNVKVIPFRKHCDWADFMVIATGRSTWHVKNIAQALIYKVKQKQKGAQRLVLPSVEGQEGGKWIVVDSGRVIVHALDEKARDYYNLEDLWASGKAEEEPQDLE KAFSKVRRKNNSKKP | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 15,498.564 | ||
Theoretical pI: | 8.956 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26470 | ||
Instability index: | 39.282 | ||
aromaticity | 0.074 | ||
GRAVY | -0.611 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.170 | ||
sheet | 0.259 |