Acc_NO	ORF type	length	start-end position (strand +/-)
>KY528486.1	internal	134	1-402(+)
Amino Acid sequence :
SLLDLHEVEKVLTDVKAGDVRVIPVGGRSGWTDFMVVASGRSAWHVRNIAQALVHKVKQKQKGSERLQLPSVEGVKGGNWIVIDSGTVIVHALEEKARSYYNLEGLWMKEMSPEEPQDLG RAFMKVRRINNSKK
Physicochemical properties
Number of amino acids:		134
Molecular weight:		15,018.143
Theoretical pI:		9.597
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24980 24980
Instability index:		59.516
aromaticity		0.060
GRAVY		-0.379
Secondary Structure Fraction
Helix		0.313
turn		0.231
sheet		0.246