| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY529019.1 | internal | 474 | 1-1422(+) |
Amino Acid sequence : | |||
| QVCKGTGHEAGFRGATYIDCPKKPCFLCKLPGNTTMTCPHRVAMEHGVVPAPHRHSRIPLDYVFERQLRREVPKIKPAFVVPDQVDCAIIKFHSRRITCLEFHPTKNNVVLSGDKKGQLG IWDYGMLHEKIVYRSIQSCILNNMKFNPVNEGILFTSSSDGTICCTDLETGIPSILMDLNPDGWHGPANWVMLYGMDTNIERGLVLVADNFGHLYLVDARTRMRSGQSILVHKKGTKVVG LHCNPVHPDLLLSCGNDHFARIWDLRRLQAGSCLESLAHGRVVNSAYFSPLTGTKILTTSEDNRIRVWDSIFGNLERSSREVVHSHDFNRHLTPFKAEWDPKDPSESLVVIGRYISENYN GVALHPIDFIDMSTGQLVAEVMEPNITTISPVNKLHPRDDILASGSSRSIFIWRPKEASKPEEEQQGKRFKEFTCGKNEKKSKGKFDDESDDDFGDFIRNCKRSRSLKSDRKPT | |||
Physicochemical properties | |||
| Number of amino acids: | 474 | ||
| Molecular weight: | 12,000.787 | ||
| Theoretical pI: | 9.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 62.433 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.413 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.204 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY529019.1 | 5prime_partial | 115 | 1421-1074(-) |
Amino Acid sequence : | |||
| VGFLSDFRDLDLLQLRIKSPKSSSLSSSNFPFDFFSFLPHVNSLKRFPCCSSSGLEASLGLQMKIDLELPDAKISSRGCSLLTGLMVVMFGSITSATSCPVLMSIKSIGCNATPL* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,000.787 | ||
| Theoretical pI: | 9.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 62.433 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.413 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.204 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY529019.1 | 3prime_partial | 103 | 309-1(-) |
Amino Acid sequence : | |||
| MKLQASDASTMEFDYCTIHLVRNHKCWLDLWNFTSQLALKNIIQRDPRVPMRRRDHPVLHCHPMWASHRRIPGQFTEKTGLFRAIDVGGASEPRLVPSPFAHL | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 12,000.787 | ||
| Theoretical pI: | 9.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 62.433 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.413 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.204 | ||
| sheet | 0.233 | ||