Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY529076.1 | internal | 171 | 1-513(+) |
Amino Acid sequence : | |||
DTEGSFMVERASQIAEACIRETLSNIFYFRICSYTEQIAVINYLDEFISEHKDVKIVIIDSITFHFRQDFDDMALRTRTLSGLALQLMKLAKKYSLAIVLLNQVTTKFTEGSFQLSFALG DSWSHACTNRIILYWNGDERYAYIDKSPSLRSDSAPFAVTNEGIRKRTRMM | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 19,707.322 | ||
Theoretical pI: | 6.351 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 43.480 | ||
aromaticity | 0.117 | ||
GRAVY | -0.108 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.175 | ||
sheet | 0.251 |