Acc_NO	ORF type	length	start-end position (strand +/-)
>KY529076.1	internal	171	1-513(+)
Amino Acid sequence :
DTEGSFMVERASQIAEACIRETLSNIFYFRICSYTEQIAVINYLDEFISEHKDVKIVIIDSITFHFRQDFDDMALRTRTLSGLALQLMKLAKKYSLAIVLLNQVTTKFTEGSFQLSFALG DSWSHACTNRIILYWNGDERYAYIDKSPSLRSDSAPFAVTNEGIRKRTRMM
Physicochemical properties
Number of amino acids:		171
Molecular weight:		19,707.322
Theoretical pI:		6.351
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		21430 21555
Instability index:		43.480
aromaticity		0.117
GRAVY		-0.108
Secondary Structure Fraction
Helix		0.339
turn		0.175
sheet		0.251