Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY529272.1 | internal | 119 | 1-357(+) |
Amino Acid sequence : | |||
DILERRNPLAFAHYANHPAKGIAPNVMICPYDFPMNEKDMRVYIPNTIFGNAEEMNMKRLGSFWFRYGSSKNPILKTLVLVATRMLCDEEILLNYRLSNLKSRPEWYTPVDEEEDKRRW | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 14,113.128 | ||
Theoretical pI: | 7.957 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 58.404 | ||
aromaticity | 0.118 | ||
GRAVY | -0.552 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.235 | ||
sheet | 0.286 |