Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY529616.1 | internal | 162 | 1-486(+) |
Amino Acid sequence : | |||
RVKNAFNGILPSKRILCFSEKTWERLRTVSILHDAIPHPHDREGHPMHIKVASRQFQSMSSSGWVYCGSHNFSAAAWGRQISSFLGHRLHICNYELGIIFIFPPSVDDIILPFVVPPPKY DRPATSKAMREALDEVEEDEPVEDEEDKTYSENLWSQIDSSN | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 18,549.674 | ||
Theoretical pI: | 5.724 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 63.276 | ||
aromaticity | 0.099 | ||
GRAVY | -0.465 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.265 | ||
sheet | 0.216 |