Acc_NO	ORF type	length	start-end position (strand +/-)
>KY530603.1	internal	150	1-450(+)
Amino Acid sequence :
SNLDSNAKMWRLVADLMNDLGMLMDLVSPLFPSAFVLIVCLGSLSRSFTAVASGATRAALTQHFALLNNAADISAKEGSQETMVTMIGMAVGMLLARITMGHPLAIWFCFLSLTFFHIFA NYKAVKCLALMSLNPQRSSILLQHFLEIGR
Physicochemical properties
Number of amino acids:		150
Molecular weight:		16,384.284
Theoretical pI:		8.591
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12615
Instability index:		40.123
aromaticity		0.087
GRAVY		0.647
Secondary Structure Fraction
Helix		0.353
turn		0.220
sheet		0.367