Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY530603.1 | internal | 150 | 1-450(+) |
Amino Acid sequence : | |||
SNLDSNAKMWRLVADLMNDLGMLMDLVSPLFPSAFVLIVCLGSLSRSFTAVASGATRAALTQHFALLNNAADISAKEGSQETMVTMIGMAVGMLLARITMGHPLAIWFCFLSLTFFHIFA NYKAVKCLALMSLNPQRSSILLQHFLEIGR | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,384.284 | ||
Theoretical pI: | 8.591 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 40.123 | ||
aromaticity | 0.087 | ||
GRAVY | 0.647 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.220 | ||
sheet | 0.367 |