Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY530685.1 | internal | 150 | 1-450(+) |
Amino Acid sequence : | |||
SNLDSNAKMWRLVADFMNDLGMLMDLVSPLFPSALIAVVCLGSLSRSFTGVASGATRAALTQHFSLQNNAADISAKEGSQETVATMVGMALGMVLAHVTRGNPLAVWMAFLSLTVFHMYA NYKAVRCLSLTTLNNERSSILLQHFMVTGQ | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,171.674 | ||
Theoretical pI: | 7.843 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 35.657 | ||
aromaticity | 0.073 | ||
GRAVY | 0.424 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.240 | ||
sheet | 0.347 |