Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY531016.1 | internal | 219 | 1-657(+) |
Amino Acid sequence : | |||
VEKFSGLRIRDQYASAVQISNRFSDTRFIRLPAIGNLLDSVDGCWATVGVLIEKGTPKTSSAGKVYSVWKMGCLDEVSVFLFGDAYVGTVFALFNSNVRNADGGFSLSVYSAAQILKMGT SVDYGVCKGKRKDGMPCTMVINKSKKPLCKYHRAELKGGNLRNAFEGIYMNAPLQNRSNTPKQAVKVMSVDGLKKALSNASQVTTKSQSQGIRFLREVT | |||
Physicochemical properties | |||
Number of amino acids: | 219 | ||
Molecular weight: | 23,899.319 | ||
Theoretical pI: | 9.772 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
Instability index: | 33.076 | ||
aromaticity | 0.087 | ||
GRAVY | -0.166 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.269 | ||
sheet | 0.205 |