Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY531041.1 | internal | 143 | 1-429(+) |
Amino Acid sequence : | |||
ISLFLFGDAYLGTVLALFNCTVRKDGSGFSLSVYTPTQVLKMGISLDYGVCKGKRKDGMACTVAINKRRGIYCKYHRTELKGGNIRSAFEGIYLLDPLADKTNLSKQPVKILSVEGLKKA LSNAGKVTTNTHSQGIRFLSEVT | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,599.017 | ||
Theoretical pI: | 9.697 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
Instability index: | 30.790 | ||
aromaticity | 0.084 | ||
GRAVY | -0.045 | ||
Secondary Structure Fraction | |||
Helix | 0.329 | ||
turn | 0.245 | ||
sheet | 0.217 |