Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY532175.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
VCDLYCDGDPEKWEEVQIGHYIGIDVSSSGISQRREAWESQRKAYTAEFFEVDPCMEDIETHLQEKTNHTDLVCCLQNLQLCFQTEERARRLLQNVSLLLKPGGYFFGITPDSSTIWAKY QKNVEAYHNRSSGMKPNIVPNCIRSENYMITFEVEEEKFPLFGKKYQLKFANDISAETHCLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNRAQLAGMLENAANLVDPRGRLLPRSFDML GLYTTFIFQKPDPDIAPPL | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 29,897.497 | ||
Theoretical pI: | 4.948 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 33390 | ||
Instability index: | 52.970 | ||
aromaticity | 0.112 | ||
GRAVY | -0.422 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.208 | ||
sheet | 0.266 |