Acc_NO	ORF type	length	start-end position (strand +/-)
>KY532256.1	internal	258	1-774(+)
Amino Acid sequence :
VCDLYCGDADKWDDAQIGHYIGIDVTSSGISEFGESWESQRKEYTAEFFEFDPCSETLESRLKDKELSADVVCCLQHLQLCFESEERVRSLLHNVSSLLRPGGYFFGIIPDSSTIWTKYQ KNVEASHNRAGGMKPSTVPNCIRSENYVITFETEEEKFPLFGKRYQLKFANDVTSEIHFLVHFPSLIRWAREAGLEYVEIQNLTEFYDDNRAQFAGMLSRFGNFVDPRGRLLPRSFDVLG LYSTFIFQKPDPDMVPPI
Physicochemical properties
Number of amino acids:		258
Molecular weight:		29,681.019
Theoretical pI:		4.881
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		36900 37275
Instability index:		45.992
aromaticity		0.132
GRAVY		-0.361
Secondary Structure Fraction
Helix		0.329
turn		0.233
sheet		0.229