Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY532256.1 | internal | 258 | 1-774(+) |
Amino Acid sequence : | |||
VCDLYCGDADKWDDAQIGHYIGIDVTSSGISEFGESWESQRKEYTAEFFEFDPCSETLESRLKDKELSADVVCCLQHLQLCFESEERVRSLLHNVSSLLRPGGYFFGIIPDSSTIWTKYQ KNVEASHNRAGGMKPSTVPNCIRSENYVITFETEEEKFPLFGKRYQLKFANDVTSEIHFLVHFPSLIRWAREAGLEYVEIQNLTEFYDDNRAQFAGMLSRFGNFVDPRGRLLPRSFDVLG LYSTFIFQKPDPDMVPPI | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 29,681.019 | ||
Theoretical pI: | 4.881 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37275 | ||
Instability index: | 45.992 | ||
aromaticity | 0.132 | ||
GRAVY | -0.361 | ||
Secondary Structure Fraction | |||
Helix | 0.329 | ||
turn | 0.233 | ||
sheet | 0.229 |