Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY532409.1 | internal | 203 | 1-609(+) |
Amino Acid sequence : | |||
QKFQKCEYSMSKLFKTEGRGWGLLADENIKAGQFIIEYCGEVISWKEARQRSQAYEAEGLKDAFIIALNAIDATRKGSLARFINHSPNCETRKWTVLGEIRVGIFAKQDILVGTELSYNY NFEWYGGAKVRCLCGATCCSGFLGAKSRGFQLWEENDDRYSVENVPLYDSAEDEQLLASQVAQEELEEARNMALDSVYDEIRP | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 23,042.637 | ||
Theoretical pI: | 4.897 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41285 | ||
Instability index: | 36.487 | ||
aromaticity | 0.113 | ||
GRAVY | -0.431 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.202 | ||
sheet | 0.296 |