Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY532556.1 | internal | 152 | 1-456(+) |
Amino Acid sequence : | |||
CETNHCIVITGRGYPDVSTRRFLRLLTDKLHLPAYCLVDCDPYGLDILMTYRFGTMQMAYDTKFLRVPEIRWIGAFPSDSEKYCLSAQCLLPLKPEDKKAEAMLLRCYLHREAPMWRLEL ENMLQRGVKFELEALSASSISFLSEVYIPAKI | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 13,043.834 | ||
Theoretical pI: | 6.816 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 62.223 | ||
aromaticity | 0.104 | ||
GRAVY | -0.172 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.252 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY532556.1 | complete | 115 | 424-77(-) |
Amino Acid sequence : | |||
MKWMMQTMLQARISPLSATCFPVPTSTLVPLGVSSISVTWLQLSYLQVLEEEDTELKGSISQNLKGKLQSSVFQARAETLYHTPFAWYRIYMSSGYPIHMDHSPPSNRQADAVYQ* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,043.834 | ||
Theoretical pI: | 6.816 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 62.223 | ||
aromaticity | 0.104 | ||
GRAVY | -0.172 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.252 | ||
sheet | 0.261 |