Acc_NO	ORF type	length	start-end position (strand +/-)
>KY532697.1	internal	184	1-552(+)
Amino Acid sequence :
DDIEEFSSDEDPYHSMCSSSKVPLHGCRVITQRQKNPLDVSEGTSQSKTVFPQLTISPLRRFQLIDSDSDDSSSRKQDLVREASNNVDLWKDFNPVTSSHIPTPAFDEMCEEYFHFVKDK DGPLPPSHSYFFHDDPRIWKLVRNRLPYFFPLGVDGRGSQQHDVSAIDYMAQFGNGEPSKRATQ
Physicochemical properties
Number of amino acids:		184
Molecular weight:		21,042.964
Theoretical pI:		5.161
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18575
Instability index:		57.078
aromaticity		0.103
GRAVY		-0.804
Secondary Structure Fraction
Helix		0.261
turn		0.283
sheet		0.152