Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY533332.1 | internal | 385 | 1-1155(+) |
Amino Acid sequence : | |||
IARSISAELSAEDLRLRFPDLLAASPAAGRASIALHRWIDSSVSQLVDYLGRRNDFAAVDQVLAAVDRLVGAGRATQAVAFFERMDRDFGLPRNTMSFVVTALCRGGFPGHAERMAKALV AEFPPDQAICDTLIGGWCADRKLHEARRFAGEVERGGFDITTAAYNALLDCTCKLCIEKDPLRMKPETEAVLLEMDERGVPRDAGTFKVLIANFCAIRQTGEALKLFERMGEWSCSADSE TYVALIKSLYGAARVEEGDEMIGRMRDAGLGADLDAEAYGSFVKTLCHIRRLDHALKVFKMMRRDRRRPAAEIYEVLIRKLQEHGRKNEADALFERAGAALEPNVCEVNPRYLKRETLPM KTERKRRRLRKLRLSFVKKPKSGMR | |||
Physicochemical properties | |||
Number of amino acids: | 385 | ||
Molecular weight: | 9,669.562 | ||
Theoretical pI: | 11.783 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 113.894 | ||
aromaticity | 0.020 | ||
GRAVY | -0.621 | ||
Secondary Structure Fraction | |||
Helix | 0.071 | ||
turn | 0.556 | ||
sheet | 0.172 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY533332.1 | 5prime_partial | 104 | 1155-841(-) |
Amino Acid sequence : | |||
SHPRLRFLYKAKPKLPQPPPLPLCLHRQSLPLQIPRVHLTHIRLQCCPRPLEKRIRLVLPPVLLQLSNQNLINLRRGPPPIPPHHLEHLQRVIEPSYVAQGLHK* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 9,669.562 | ||
Theoretical pI: | 11.783 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 113.894 | ||
aromaticity | 0.020 | ||
GRAVY | -0.621 | ||
Secondary Structure Fraction | |||
Helix | 0.071 | ||
turn | 0.556 | ||
sheet | 0.172 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY533332.1 | 5prime_partial | 99 | 2-301(+) |
Amino Acid sequence : | |||
SRAPSPPSSPPKTSAFASLTSSPPPPPPAAPPSPSTAGSTPRSPSSSTTSAAATTSRPSIRCSPPSTASSAPGEPPRLSRSLRGWTGTSACLGTRCPSS* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 9,669.562 | ||
Theoretical pI: | 11.783 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 113.894 | ||
aromaticity | 0.020 | ||
GRAVY | -0.621 | ||
Secondary Structure Fraction | |||
Helix | 0.071 | ||
turn | 0.556 | ||
sheet | 0.172 |