Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY533364.1 | 3prime_partial | 191 | 1-573(+) |
Amino Acid sequence : | |||
MRNKKKASDSITLINRDSTFGFVPHEKNVYEGERLTCLLQSIKTKIESAKLVDGDNLPEKFWFKQQFAIGINEVTRVLERMTSSADVVNSAQQPCSSCHRKAPSVQLQAVLLASDCNPRW LTKHIQSLALSRDIPLIFIKDKKAGSLRLGELVKIKTAIAIGVKAKGNLINELFQKILHGDLVDLGTDCVK | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 21,256.525 | ||
Theoretical pI: | 9.419 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 36.851 | ||
aromaticity | 0.052 | ||
GRAVY | -0.180 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.209 | ||
sheet | 0.241 |