Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY534098.1 | internal | 254 | 1-762(+) |
Amino Acid sequence : | |||
ARLSALATTTMSQGYHQPTTVEEVRTLWIGDLQYWVDENYLSSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERILQTYNGTQMPGTELTFRLNWASFGIGEKRPDAGPEHTI FVGDLAPDVTDYLLQETFRAQYPSVRGAKVVTDPNTGRSKGYGFVKFSDETERNRAMTEMNGVYCSTRPMRISAATPKKTTAFPQQFAAAKAVYPVPAYTTPAVPVLPTDYDANNTTVYV GNLDPNVTEEELKQ | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 28,153.234 | ||
Theoretical pI: | 5.460 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 35995 | ||
Instability index: | 33.926 | ||
aromaticity | 0.106 | ||
GRAVY | -0.395 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.228 | ||
sheet | 0.232 |