Acc_NO	ORF type	length	start-end position (strand +/-)
>KY534287.1	internal	181	1-543(+)
Amino Acid sequence :
RRGFAKGRKDIGPAAKSAAASQMEAAMVALSRDLSKLRTGRASAGMLDHIIVEVSGAKVPLSHIAVVSVLDSKTLSVMPYDTNTLKELEKAIVSSPLGLNPTVDGQRLLASVPRLTKEHV QAMCKLVNKSSEDVKQSIRRARQKALDTIKKVKRLEKEIEELTKKFVKSADDVCKAKEKEI
Physicochemical properties
Number of amino acids:		181
Molecular weight:		19,744.894
Theoretical pI:		9.866
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		41.904
aromaticity		0.017
GRAVY		-0.305
Secondary Structure Fraction
Helix		0.260
turn		0.188
sheet		0.304