Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY534287.1 | internal | 181 | 1-543(+) |
Amino Acid sequence : | |||
RRGFAKGRKDIGPAAKSAAASQMEAAMVALSRDLSKLRTGRASAGMLDHIIVEVSGAKVPLSHIAVVSVLDSKTLSVMPYDTNTLKELEKAIVSSPLGLNPTVDGQRLLASVPRLTKEHV QAMCKLVNKSSEDVKQSIRRARQKALDTIKKVKRLEKEIEELTKKFVKSADDVCKAKEKEI | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 19,744.894 | ||
Theoretical pI: | 9.866 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 41.904 | ||
aromaticity | 0.017 | ||
GRAVY | -0.305 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.188 | ||
sheet | 0.304 |