Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY535113.1 | internal | 277 | 1-831(+) |
Amino Acid sequence : | |||
GTASPIQRTFVGIDFFSVFQEIYLRTNDPRVSNIVKFSDAIGELKVEAVASTKNGKRILFQFDRAAFSLKFLPFKVPYPVPFRLLGDEAKGWLDTTYLSHSGNLRISRGNKGTTFVLQKK IEPRQKLLSAISNLKDVQEAIDEFISFHQKRGKDRAELAEGEWKMIWSSQTETDSWLENAANGLMGKQIVKKSGQIKFLVDVLLGIKFSMSGTLVKSGPTTYKVSMDDAALVAGGFGYPL EMESKFNEMQVLYGDEKIRITRGHSKIIFVHLRTDGL | |||
Physicochemical properties | |||
Number of amino acids: | 277 | ||
Molecular weight: | 31,125.489 | ||
Theoretical pI: | 9.463 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 30940 | ||
Instability index: | 24.696 | ||
aromaticity | 0.105 | ||
GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
Helix | 0.332 | ||
turn | 0.227 | ||
sheet | 0.231 |