Acc_NO	ORF type	length	start-end position (strand +/-)
>KY535564.1	3prime_partial	215	1-645(+)
Amino Acid sequence :
MMDTWINNHRQMYDRATRHPFVLSVRDGTVDSSSFKRWLGQDYIFVRQFVPFLASVLLKACRESEDQSDVEVLLGGIASLHDELSWFKKEASKWDVMLNAITPQKANQDYCRFLESLMLP EVDYTVAITAFWAIESVYQKSFSSCLEASSNTPAELMETCQRWGNDGFGQYCCALCGIAERRLGIASEDVVTMAEGVFVRVLESEVRFWDMSYGE
Physicochemical properties
Number of amino acids:		215
Molecular weight:		24,612.652
Theoretical pI:		4.774
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		48930 49305
Instability index:		45.130
aromaticity		0.121
GRAVY		-0.146
Secondary Structure Fraction
Helix		0.326
turn		0.195
sheet		0.274