Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY535986.1 | internal | 200 | 1-600(+) |
Amino Acid sequence : | |||
TLRSSSSAASLQLCIRLNEPDSSGFGPLKPWDTPVVVEKSQPLNVWDLSDSESAPASSWSTLPNRSLLCRPLPLDVGRCTCIIVKEASQGLDGMSVYSLYTNEGPGRQDRKLAVARHRRR NGRSEFIVAQNEKGIVCSSDECFLGALTANLMGSRYHIWDQGSPHDLIRKQPKRLLGAVAFVPTIKTLTGSYRSMRAWIP | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 22,040.929 | ||
Theoretical pI: | 9.297 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33835 | ||
Instability index: | 56.212 | ||
aromaticity | 0.065 | ||
GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.300 | ||
sheet | 0.230 |