Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY536605.1 | 3prime_partial | 211 | 1-633(+) |
Amino Acid sequence : | |||
MGAKAKKALIKKQKKTSYSGKKESYDFLPLEGGPGKEIREEEVYVKNTDTVVYIGRIPHGFYEEQMEAFFKQFGAIKRLKIARNKKTGNSKHYGFIEFESPEVAKIVADCMHNYLLFEHM LQVHLVPSDRVHPKLWFGANRQFQPAKTREIERKKHNKERTIEQHRHLVEGILKRDQKRRKRLADAGIDYECPDFVGGIPCAPKKIKFDED | |||
Physicochemical properties | |||
Number of amino acids: | 211 | ||
Molecular weight: | 24,603.123 | ||
Theoretical pI: | 9.546 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
Instability index: | 53.815 | ||
aromaticity | 0.100 | ||
GRAVY | -0.826 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.175 | ||
sheet | 0.232 |