Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY536637.1 | 3prime_partial | 144 | 1-432(+) |
Amino Acid sequence : | |||
MDLSEIAKRLGLSDSKNLIRKAAELRRLCDVQFDSSVIGVGEVCKAVICMEIAASRLGILLDRSSAIKLSGLSEKAYTRSYNSLQNGLGVKNKLDVRELAIQFGCVRIIPFVQKGLSLFK DRFLASLPASRRATADFTRPVFTA | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 15,809.343 | ||
Theoretical pI: | 9.778 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 46.488 | ||
aromaticity | 0.063 | ||
GRAVY | 0.122 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.215 | ||
sheet | 0.285 |