Acc_NO	ORF type	length	start-end position (strand +/-)
>KY536704.1	internal	152	1-456(+)
Amino Acid sequence :
ELRRLCDVRFDSSLIGVGEVCKSIICLEIAASRLQAMFDRQAAIRVSGMSEKAYIRSSNALQNCLGVKTKLDVRELGIQFGCVRLIPFVQKGLSAYKERFLAALPASRRATTDFSRPVFT AVAFYLSAKKHKLKVDKLKLIELCGTSESEFT
Physicochemical properties
Number of amino acids:		152
Molecular weight:		16,925.697
Theoretical pI:		9.589
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		4470 4845
Instability index:		51.628
aromaticity		0.079
GRAVY		0.088
Secondary Structure Fraction
Helix		0.329
turn		0.178
sheet		0.289