Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY536704.1 | internal | 152 | 1-456(+) |
Amino Acid sequence : | |||
ELRRLCDVRFDSSLIGVGEVCKSIICLEIAASRLQAMFDRQAAIRVSGMSEKAYIRSSNALQNCLGVKTKLDVRELGIQFGCVRLIPFVQKGLSAYKERFLAALPASRRATTDFSRPVFT AVAFYLSAKKHKLKVDKLKLIELCGTSESEFT | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,925.697 | ||
Theoretical pI: | 9.589 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 51.628 | ||
aromaticity | 0.079 | ||
GRAVY | 0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.329 | ||
turn | 0.178 | ||
sheet | 0.289 |