Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY537161.1 | internal | 241 | 1-723(+) |
Amino Acid sequence : | |||
DAELRLPLQDVFIDLYDKIKPSETIWYIDEDQLVINLKKHDSDLKWPDVKETWASLTTGVLQLLKGTSVYTVGESTEVNEIVAKELAVGLGYIPLNTSELLEKQSIDSWMIAEGADSVAE AEATILESLSSHVRAAVGTLGEPFGAAGRADKWRHLHSGFAIWLSQCDTADEASAKEEAYSNADVVVKLGGWDRIVAQTCLSALKQLILSDKTLTGKKSLYIRLGCRGDWPNIKPPGWDP S | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 26,483.660 | ||
Theoretical pI: | 4.750 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 58440 58565 | ||
Instability index: | 27.612 | ||
aromaticity | 0.075 | ||
GRAVY | -0.177 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.212 | ||
sheet | 0.290 |