Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY537293.1 | internal | 473 | 1-1419(+) |
Amino Acid sequence : | |||
RRITDPRFASAQSDPRFQRAPSLKSKVSIDSRFNKMFSDKRFSASSAPVDKHGRTNRLRHYYRQENVPVEQETHRLSAVHMDWDNIKAVDLYVLLSSFLPKGGQILQVSIYPSEFGIKRM EEEAVRGPVGVFDGEEEVDQKKVCQYELDKLRYYFAVIECDSPATADHLYNSCNGHEVELSGNFLDLRFIPDSMEFKHPPRDVAKQAPSNYEALNFQTDVLQQSKVNLTWDDDEPERKKI LRRKFNPEQLSELEFKDFLASDDDSEDDNENDDQSKLSKAAKYQALIQSGDGSDAEDNGDKDMEITFNPGLEDISKHILEKKDKGSETVWEAYLRKKREKKKARKNASKYSSDDDSGEDP DQPDDFFDEESSGSDEREVSRAELELLLADGQGNGTNLKGYNLKGKKDEEKLPSVDYDDTRFSALFNSHLFALDPTDPQFKRSAAYYRQLAKKQSKGKEKHELSFLVRSVKNK | |||
Physicochemical properties | |||
Number of amino acids: | 473 | ||
Molecular weight: | 11,451.962 | ||
Theoretical pI: | 9.389 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 89.035 | ||
aromaticity | 0.121 | ||
GRAVY | -0.455 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.333 | ||
sheet | 0.192 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY537293.1 | complete | 99 | 1240-941(-) |
Amino Acid sequence : | |||
MEASPRLFYLSNYSPSSWYHYPAHLQVTIQVPPDSLLVHLIQKIPHQRNHQVGQDPRRYHHPMSTLKRSSSLSSFPSSFLGMPPRLFLSPCPSFQEYAC* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,451.962 | ||
Theoretical pI: | 9.389 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 89.035 | ||
aromaticity | 0.121 | ||
GRAVY | -0.455 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.333 | ||
sheet | 0.192 |